PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G120600.4.p
Common NameSb05g017510, SORBIDRAFT_05g017510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 326aa    MW: 34172.1 Da    PI: 8.6771
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G120600.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.31.6e-4178154278
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           C v+gC++dls+++eyhrrhkvCe+hsk+pvv+v+g+eqrfCqqCsrfh+lsefDe+krsCr+rL++hn+rrrk+q+
  Sobic.005G120600.4.p  78 CSVDGCRSDLSRCREYHRRHKVCEAHSKTPVVVVAGQEQRFCQQCSRFHMLSEFDEGKRSCRKRLDGHNRRRRKPQH 154
                           **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-3471139IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.34275152IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-3977157IPR004333Transcription factor, SBP-box
PfamPF031107.9E-3178151IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MDWAAASGAP SWGAAATDPG PTMLSFAGPS SSTTPAADAE ARLQDFAAGL AQSARPAGAA  60
GAGRRSRAAG GGAGVEACSV DGCRSDLSRC REYHRRHKVC EAHSKTPVVV VAGQEQRFCQ  120
QCSRFHMLSE FDEGKRSCRK RLDGHNRRRR KPQHDLTNLG GFFPYHQVNQ FEVYPRTIPT  180
VGQNSDAMHL VGRQQPFSIS FSRTPNQFPF PQGGGSTLHA ARPGHLLAEG SSHTGSSTCS  240
NPLSGTLGPE CALSLLSSSL HHPSAAGIPT AGQPQVASSL SRIAAVSQAA TTAMATAFAA  300
GVGHHVFVPD AMFEDPSQAL PFSWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2969151284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134151KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0646940.0BT064694.1 Zea mays full-length cDNA clone ZM_BFb0036O07 mRNA, complete cds.
GenBankBT0652750.0BT065275.1 Zea mays full-length cDNA clone ZM_BFb0077F03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450775.10.0hypothetical protein SORBIDRAFT_05g017510
SwissprotQ2R3Y11e-101SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLC5Y2L50.0C5Y2L5_SORBI; Putative uncharacterized protein Sb05g017510
STRINGSb05g017510.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-42SBP family protein